PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv9_221110_kzoy.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 380aa    MW: 42463.1 Da    PI: 8.9316
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv9_221110_kzoy.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1248.2e-082432891763
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         A+rsR RK+++i+eLe+ v++L+ae ++   ele l+++   l +e+
  Bv9_221110_kzoy.t1 243 AQRSRVRKLQYIAELERSVQSLQAEGSEVSAELEFLNQQNLILSMEN 289
                         89***********************************9998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-4232291IPR004827Basic-leucine zipper domain
CDDcd147032.03E-15234282No hitNo description
SuperFamilySSF579598.13E-6243285No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-6243286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MANPKGSANI RNLMQNGKNS LLPPKSPFPS ITPAYPDYGP NTCLGSKSAL RCRDGNSYHQ  60
RTSSESVIEE QPSWLDELLN EPETPVRRGH RRSSSDSFAY SDAANMSNMD YMVPLDETKF  120
KSMVSSSLWG SQNFDLSKET LQGSFHHDSN FYGKLRNRSL ELKLAPSNHT NGLRSSRDKA  180
VTQSAGASAA ALELDSIPST AAEKLDQSES GSHDPKSFFE KKDGSHAKTP SENDTKRAKQ  240
QFAQRSRVRK LQYIAELERS VQSLQAEGSE VSAELEFLNQ QNLILSMENK ALKQRLESLA  300
QEKLIKYLEH EVLEREIGRL RALYQQQQQQ SQLQPQPHQR PSSSHRRTNS RDLDAQFANL  360
GLKHKETSSG ADPFSGPVGI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010691351.10.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLA0A0J8ECU40.0A0A0J8ECU4_BETVU; Uncharacterized protein
STRINGVIT_12s0035g00620.t011e-153(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.28e-89bZIP family protein